Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

In Stock
Code CSB-YP639324FLF
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP639324FLF could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain NCTC 8325) hly.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP639324FLF could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus (strain NCTC 8325) hly.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
hly
Uniprot No.
Research Area
Others
Alternative Names
hly; hla; SAOUHSC_01121Alpha-hemolysin; Alpha-HL; Alpha-toxin
Species
Staphylococcus aureus (strain NCTC 8325)
Source
Yeast
Expression Region
27-319aa
Target Protein Sequence
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
35.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant full-length of Mature Staphylococcus aureus Alpha-hemolysin (hly) Protein (27-319 amino acids) with a 6xHis tag at the C-terminus was expressed in the yeast. SDS-PAGE analysis of the purified hly protein gave one band at 34–40 kDa of the target molecule. The purity of this hly protein is greater than 90%. The identification of the hly protein was validated by the LC-MS/MS Analysis. The delivery time is relatively short because the hly protein is in-stock.

Alpha-hemolysin (hly), also known as hla, is a single component toxin generated by Staphylococcus aureus, a potential human causative agent that can cause various acute and chronic infections. Hly plays an important role in the pathogenesis of Staphylococcus aureus. The interaction between hly and the specific cell receptor ADAM10 forms cylindrical transmembrane heptameric pores. The resulting pores allow the influx and efflux of ions and small molecules, ultimately leading to disruption of ionic equilibrium, osmotic expansion, and cell death.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

If there will be a link between the C-terminal and His-Tag? And do you do any assembly tests with the C-Terminal?

A:

Yes, typically, there's a linker connecting the tag to the target protein. As for the "assembly tests with the C-Terminal" you mentioned, could you specify which tests you are referring to? We have previously developed multiple recombinant proteins with C-terminal His tags and have extensive experience in this area. If you can provide more information, we can offer detailed solutions.

Q:

I need Alpha-hemolysin protein for nanopore sensing. Is it a ready-to-use Alpha-hemolysin protein for doing nanopore sensing? I mean can I use that to form pores on the phospholipid bilayer membrane?

A:

We haven't done related test, we are not sure if it can be used for nanopore sensing.
If you order the yeast Alpha-hemolysin Protein CSB-YP639324FLF, we can proivde a 20ug free sample of E.coli Alpha-hemolysin Protein CSB-EP639324FLFc7.

Target Background

Function
Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Inhibits host neutrophil chemotaxis to the lesion region (Probable). Heptamer oligomerization and pore formation is required for lytic activity.
Gene References into Functions
  1. We now show that ADAM10 is critical for alpha-hemolysin-mediated activation of the NLRP3 inflammasome in human monocytes as siRNA knockdown or chemical blockade of ADAM10-alpha-hemolysin interaction leads to diminished inflammasome activation and cell death by reducing the available ADAM10 on the cell surface. PMID: 27043625
  2. Staphylococcus aureus hemolysin A disrupts cell-matrix adhesions in human airway epithelial cells. PMID: 24918472
  3. Succeeded in preparing crystals of the heptameric form of alpha-hemolysin without any detergent but with 2-methyl-2,4-pentanediol (MPD), and determined its structure. PMID: 21280135
  4. Staphylococcus aureus alpha-hemolysin activates the NLRP3-inflammasome in human and mouse monocytic cells PMID: 19826485
  5. The wide vestibule leading into the alpha-hemolysin pore helps to orient negatively charged synthetic alpha-helical peptides for translocation. PMID: 16866363

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Aerolysin family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*